PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_32408_BGI-A2_v1.0
Common NameF383_16691
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SRS
Protein Properties Length: 306aa    MW: 33903.6 Da    PI: 6.501
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_32408_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702232.85.7e-72902402154
                      DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqs 84 
                                 ++g+++CqdCGnqakkdCah+RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa++++++++ +   ++ kr  +++ + 
  Cotton_A_32408_BGI-A2_v1.0  90 KHGGMNCQDCGNQAKKDCAHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQHHQQHEDQFRGENPKRLRENQGSP 172
                                 6899******************************************************9999988855555555555568888 PP

                      DUF702  85 alsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                                 +l++t+ls ++s   le  ++P+evss+avfrcv+vs++dd++ee+aYqtav+i+GhvfkGiLydqG+e+
  Cotton_A_32408_BGI-A2_v1.0 173 SLACTRLSPTTSG--LELGQFPPEVSSPAVFRCVKVSAMDDEDEEFAYQTAVNIAGHVFKGILYDQGPES 240
                                 9999999988765..88899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.9E-6893239IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.1E-2795137IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.8E-27190238IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAGLFYLGGR EADTGNKQEE DKEESLYLYR NEEIYNKGFE IWPQYYYQQQ QQQQENVNTI  60
SFGAGPSRIA TGFNLSDEPS SRSVGFTVMK HGGMNCQDCG NQAKKDCAHM RCRTCCKSRG  120
FQCQTHVKST WVPAAKRRER QQQLAALQHH QQHEDQFRGE NPKRLRENQG SPSLACTRLS  180
PTTSGLELGQ FPPEVSSPAV FRCVKVSAMD DEDEEFAYQT AVNIAGHVFK GILYDQGPES  240
HYTGGGESSQ QLNLITAAVT TAETARTTTT AATSSNAGTS MLDPCLYPAP LNAFIAGTQF  300
FPPPRS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6162871e-176JX616287.1 Gossypium hirsutum clone NBRI_GE60826 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466169.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ51e-104SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0B0NK510.0A0A0B0NK51_G
STRINGPOPTR_0002s03000.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.18e-90SHI-related sequence 5